PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_66924.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 167aa    MW: 19238 Da    PI: 9.3463
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_66924.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1713.7e-53111391128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                   +ppGfrFhPt+eel+++yL+kkv++++++l +vi+++d++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++
  MLOC_66924.1  11 VPPGFRFHPTEEELLNYYLRKKVASEEIDL-DVIRDIDLNKLEPWDIQEkcKIGSgPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYN 106
                   69****************************.9***************952444443456************************************** PP

           NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +g++ktLvfykgrap+g+k+dW+mheyrl
  MLOC_66924.1 107 -AVKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                   .8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.19E-547142IPR003441NAC domain
PROSITE profilePS5100551.98711161IPR003441NAC domain
PfamPF023654.8E-2912139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MSISVNGQSC VPPGFRFHPT EEELLNYYLR KKVASEEIDL DVIRDIDLNK LEPWDIQEKC  60
KIGSGPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYNAVKR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD DLPTIVTDAA PTATMVRMRD HLAQLCS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-461113915140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2484490.0AK248449.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf176e18, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008648393.11e-104PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-93NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM0Y9971e-125M0Y997_HORVD; Uncharacterized protein
STRINGMLOC_66924.21e-113(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.15e-84NAC family protein